Α-defensyny

Z Wikipedii, wolnej encyklopedii
Skocz do: nawigacja, szukaj
Budowa HNP3

α-defensyny - białka kationowe o długości 29-35 aminokwasów, zawierające trzy mostki dwusiarczkowe w pozycjach C1-C6, C2-C4 i C3-C5. Należą do nich tak zwane ludzkie białka neutrofilowe (zlokalizowane w ich ziarnistościach azurofilnych) HNP (human neutrophil peptides) -1, -2, -3, i -4 oraz wytwarzane przez komórki Paneth’a w kryptach jelita cienkiego ludzkie defensyny HD -5 i -6 [1] (human defensins) zwane kryptydynami. Pierwszą ludzką defensynę wyizolowano z neutrofilów w 1985 roku [2]. Defensyny są nie tylko są wytwarzane w jelitach, ale występują również obficie w innych ludzkich komórkach i tkankach m.in. w wydzielinie dróg rodnych kobiet wykrywana jest HNP-3, której stężenie jest uzależnione w minimalnym stopniu od fazy cyklu menstruacyjnego [3]. Stężenie defensyn w granulocytach obojętnochłonnych, w komórkach nabłonka dróg oddechowych i w wydzielinie dróg oddechowych zmienia się wyraźnie w ostrych stanach zapalnych, zwłaszcza w plwocinie pacjentów z mukowiscydozą [4].

Sekwencje genów poszczególnych defensyn[5]

Gen Nazwa Peptyd Sekwencja
DEFA1 HNP1 HNP1 ACYCRIPACIAGERRYGTCIYQGRLWAFCC
HNP2 HNP2 CYCRIPACIAGERRYGTCIYQGRLWAFCC
DEFA3 HNP3 HNP3 DCYCRIPACIAGERRYGTCIYQGRLWAFCC
DEFA4 HNP4 HNP4 VCSCRLVFCRRTELRVGNCLIGGVSFTYCCTRV
DEFA5 HD5 HD5 ATCYCRHGRCATRESLSGVCEISGRLYRLCCR
DEFA6 HD5 HD6 AFTCHCRRSCYSTEYSYGTCTVMGINHRFCCL

Przypisy

  1. NH Salzman, D Ghosh, KM Huttner, Y Paterson i inni. Protection against enteric salmonellosis in transgenic mice expressing a human intestinal defensin.. „Nature”. 422, s. 522-526, 2003. 
  2. T Ganz, M Selsted, D Szklarek, SS Harwig i inni. Defensins. Natural peptide antibiotics of human neutrophils.. „J Clin Invest”. 76, s. 1427-1435, 1985. 
  3. EV Valore, CH Park, SL Igreti, T Ganz. Antimicrobial components of vaginal fluid.. „Am J Obstet Gynecol”. 187, s. 561-568, 2002. 
  4. T Ganz. Antimicrobial polypeptides in host defense of the respiratory tract.. „J Clin Invest”. 109, s. 693-697, 2002. 
  5. DME Bowdish, DJ Davidson, REW Hancock. Immunomodulatory Properties of Defensins and Cathelicidins. „CTMI”. 306, s. 27–66, 2006.